PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004506754.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family Trihelix
Protein Properties Length: 276aa    MW: 33506.6 Da    PI: 6.8046
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004506754.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix75.11.2e-2342124186
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     +W+ +e+++ + +r e+++++ ++k++k+lWe ++++m+e g+ rs++qCk+kw+nl +ryk +++++ +     ++++p++++l+
  XP_004506754.1  42 QWSIEETKVFLMLRGELDQAFMETKRNKQLWEVIANHMKENGYYRSAEQCKCKWKNLVTRYKGCETMDTEV--L-RHQFPFYNELQ 124
                     7********************************************************************96..3.3479****997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.002239101IPR001005SANT/Myb domain
CDDcd122034.53E-2241106No hitNo description
PfamPF138371.2E-2142126No hitNo description
PROSITE profilePS500907.8284399IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MEGHQFHHKN QRRQQQQQQQ QQQNIHQNIN TVNVDVSDRF PQWSIEETKV FLMLRGELDQ  60
AFMETKRNKQ LWEVIANHMK ENGYYRSAEQ CKCKWKNLVT RYKGCETMDT EVLRHQFPFY  120
NELQAIFTAR MQRMLWAEAE DGSKKKATEI STDDEDDNEE NETVSQKGSN RKKKKAKTVS  180
ESGGVSNNNL KEILDDFMRQ MLQIEAQWME SFEARENERR LREMEWRQQM EVLENERILM  240
EQRWREREEQ RMIREEARAE KRDALIRALL NKLERQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004506754.10.0PREDICTED: trihelix transcription factor GT-3b
SwissprotO804504e-67TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLG7JN341e-129G7JN34_MEDTR; Trihelix transcription factor GT-3a-like protein
STRINGGLYMA03G07590.21e-119(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.17e-64Trihelix family protein